Transcript | Ll_transcript_97408 |
---|---|
CDS coordinates | 2-334 (+) |
Peptide sequence | TFIDDFGRNIWLYLIKLKSDVFNIFKSFKCMAEKQSERSIKIMRNDGGGEFTSKELDLFCIENDILHEVVAPYTPQHNGEAKRRNIIILNIVRAPTVVVLNIIKTFLFCSS |
ORF Type | internal |
Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 44.68% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 44.68% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439003.1) |
Pfam | Integrase core domain (PF00665.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer