Protein coding transcript 131442

• Transcript: Ll_transcript_26730
• CDS coordinates: 1-330 (+)
• Peptide sequence: TDHGNRRLDQAFSSSDKKKIFLLYSVNGSGHFCGVAEMISAVDYNSSSSVWCQDKWKGQFGVRWIYVKDVPNNQLRHIRLENNENKPVTHSRDTQEVPYNQGVQVLRIIH
• ORF Type: internal

Annotations of Ll_transcript_26730

• Blastp: YTH domain-containing family protein 1 from Mus with 72.73% of identity
• Blastx: YTH domain-containing family protein 1 from Mus with 72.73% of identity
• Eggnog: YTH domain family(ENOG410YABQ)
• Kegg: Link to kegg annotations (228994)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016197120.1)
• Pfam: YT521-B-like domain (PF04146.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;