Protein coding transcript 131443

• Transcript: Ll_transcript_26736
• CDS coordinates: 88-573 (+)
• Peptide sequence: MVMKCLFMIFFLLGYAESQSSMHPFNHTDLQAAIGDMRSKSYYGFAMLLQMLNGTSVEPTRELTFFMPDDRELSSSAISADQIEEFLLKHAIPMPLYYNDLSHFPTGTLVPSGLSSKMMRIHNRGRGDFFVNNAQIVSSNVCLSSEIKCHGIDAIIEYDST*
• ORF Type: complete

Annotations of Ll_transcript_26736

• Blastp: FAS1 domain-containing protein SELMODRAFT_448915 from Selaginella with 26.28% of identity
• Blastx: FAS1 domain-containing protein SELMODRAFT_448915 from Selaginella with 26.28% of identity
• Eggnog: CASP-like protein(ENOG410YHDU)
• Kegg: Link to kegg annotations (SELMODRAFT_448915)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425124.1)
• Pfam: Fasciclin domain (PF02469.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;