Protein coding transcript 131449

• Transcript: Ll_transcript_262209
• CDS coordinates: 1-423 (+)
• Peptide sequence: QSSYNNLISNIVIEIPSINTTGFDLLSYDIQRGRDVGLPPYTKMRSLCGLPQAKSFDDLSDYIPSKKIDQLKNFYSSVDDIDYYVGILLEDKVIGSMFGPTGSCVIADSFYRFRNGDRFFYDVKDQPGSFTSDQLQSLKKI
• ORF Type: internal

Annotations of Ll_transcript_262209

• Blastp: Peroxidase mlt-7 from Caenorhabditis with 45.74% of identity
• Blastx: Peroxidase mlt-7 from Caenorhabditis with 45.74% of identity
• Eggnog: prostaglandin G H synthase and cyclooxygenase(ENOG410XPZ3)
• Kegg: Link to kegg annotations (CELE_ZK430.8)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013450851.1)
• Pfam: Animal haem peroxidase (PF03098.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;