Transcript | Ll_transcript_144527 |
---|---|
CDS coordinates | 3-548 (+) |
Peptide sequence | QMDGAILVVAATDGAMPQTREHLLLAKQIGIGHIIVFINKVDAADSEMVELVEMEIRELLSEMGFDGENLPVIKGSALCALEGKEPEIGEKAIDALLAEVDKYVPQPIRDLDKPFMLPVEHVYSIPGRGTVVTGRLERGIIKKGNECEFVGYNKVIKSTITGVEMFHKILEEAQAGDQLGAL |
ORF Type | internal |
Blastp | Elongation factor Tu, mitochondrial from Mus with 70.33% of identity |
---|---|
Blastx | Elongation factor Tu, mitochondrial from Mus with 70.33% of identity |
Eggnog | This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis (By similarity)(COG0050) |
Kegg | Link to kegg annotations (233870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003594095.2) |
Pfam | Elongation factor Tu GTP binding domain (PF00009.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer