Protein coding transcript 131458

• Transcript: Ll_transcript_169322
• CDS coordinates: 2-409 (+)
• Peptide sequence: KEIPQMPDEQQSWMSFLSKAVTASANYLPTQVTDVFNQGRAVASIHLPFQGLKNICTIVMVDKVLRLLVASSHGYLYVYNLDMEEGGECTLWRTHRLDGQLDVVDSPKPIKLKEVNTTKLDKTTKTESTINKKLDA
• ORF Type: internal

Annotations of Ll_transcript_169322

• Blastp: WD repeat domain phosphoinositide-interacting protein 2 from Mus with 53.85% of identity
• Blastx: WD repeat domain phosphoinositide-interacting protein 2 from Mus with 53.85% of identity
• Eggnog: The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Necessary for proper vacuole morphology. Plays an important role in osmotically-induced vacuole fragmentation. Required for cytoplasm to vacuole transport (Cvt) vesicle formation, pexophagy and starvation-induced autophagy. Involved in correct atg9 trafficking to the pre-autophagosomal structure. Might also be involved in premeiotic DNA replication (By similarity)(ENOG410XP6Y)
• Kegg: Link to kegg annotations (74781)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445933.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;