Protein coding transcript 131460

• Transcript: Ll_transcript_160321
• CDS coordinates: 2-364 (+)
• Peptide sequence: LGDTCTRGCRFCSIKTSRNPPPPDPKEPVNTATAIATWGLDYVVLTSVDRDDLLDGGSMHFAETVREIKRQNSDILVECLVPDFRGNLDHVKNIVECGLDVYAHNIETVGSLTLLVRDRRA
• ORF Type: internal

Annotations of Ll_transcript_160321

• Blastp: Lipoyl synthase, mitochondrial from Sophophora with 78.51% of identity
• Blastx: Lipoyl synthase, mitochondrial from Sophophora with 78.51% of identity
• Eggnog: Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives (By similarity)(COG0320)
• Kegg: Link to kegg annotations (Dmel_CG5231)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003555873.1)
• Pfam: Radical SAM superfamily (PF04055.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;