| Transcript | Ll_transcript_160319 |
|---|---|
| CDS coordinates | 3-413 (+) |
| Peptide sequence | TIKGFSSSSILNRIQTKNFQTSTKIEALREEIRFMIERDGSAKGIVFSQFTPFLDLIGYSLEKSGVSCIQLNGSMSLPARDAAIKKFTDDPNYKIFLVSLKAGGVALNLTVASHVFFMDPWWNSAVERQAQDRINRI |
| ORF Type | internal |
| Blastp | ATP-dependent helicase rhp16 from Schizosaccharomyces with 58.65% of identity |
|---|---|
| Blastx | ATP-dependent helicase rhp16 from Schizosaccharomyces with 58.65% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447734.1) |
| Pfam | Helicase conserved C-terminal domain (PF00271.30) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer