Protein coding transcript 131465

• Transcript: Ll_transcript_59053
• CDS coordinates: 3-401 (+)
• Peptide sequence: NNKCKCLLYNVLKRTASSRPPQTVFIEKILEDPVVVLREEDDVDLIGPPDAVSNLRPIIRKRLLNETPLQVKLRELQDSTHAWNNEFWAKHNTRFVSERLAYIESHQVKGEEQKQLTADEMSEFYKSFLDKNW
• ORF Type: internal

Annotations of Ll_transcript_59053

• Blastp: APOPT family protein CG14806, mitochondrial from Sophophora with 47.22% of identity
• Blastx: APOPT family protein CG14806, mitochondrial from Sophophora with 50% of identity
• Eggnog: apoptogenic 1, mitochondrial(ENOG4111VRW)
• Kegg: Link to kegg annotations (Dmel_CG14806)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463571.1)
• Pfam: Uncharacterised conserved protein (DUF2315) (PF10231.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;