Protein coding transcript 131469

• Transcript: Ll_transcript_59099
• CDS coordinates: 3-311 (+)
• Peptide sequence: VSSAKMPLDGYLSLLKTHGTFIQVGAPDGGELPPINAFTLLSGGLKVGGSGIGAPWEIKEMLELAAEKKIKPWIQKRPMKDANTAVVDMEAGKARYRYVLEN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_59099

• Blastp: Aldehyde reductase Ahr from Escherichia with 38.71% of identity
• Blastx: Probable cinnamyl alcohol dehydrogenase 3 from Oryza sativa with 38% of identity
• Eggnog: alcohol dehydrogenase(COG1064)
• Kegg: Link to kegg annotations (JW5761)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020989201.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;