| Transcript | Ll_transcript_59067 |
|---|---|
| CDS coordinates | 153-488 (+) |
| Peptide sequence | MVEPNRIWGDKCSMADIVITQGPTTPLPNGIPTYTVDIINMCLNGCDISGIHLSCGWFSSARLINPKLFKRLHYNDCLVNDGRPLINGDSISFQYANTFLYPLSVSKVICV* |
| ORF Type | complete |
| Blastp | Protein TAPETUM DETERMINANT 1 from Arabidopsis with 61.82% of identity |
|---|---|
| Blastx | Protein TAPETUM DETERMINANT 1 from Arabidopsis with 61.82% of identity |
| Eggnog | NA(ENOG410YPRQ) |
| Kegg | Link to kegg annotations (AT4G24972) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437512.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer