Transcript | Ll_transcript_59076 |
---|---|
CDS coordinates | 3-314 (+) |
Peptide sequence | SRDMVDCLKQRPALDLLKKSIESEDDLLAMDFVPVVDGDFLPKAPLEILMEKNLPDIPWIFSNTAEDGIMPSGLFAEKFDEVNEEWSKMAPHILLFSKTQPQSD |
ORF Type | internal |
Blastp | Esterase S from Drosophila with 27.87% of identity |
---|---|
Blastx | Esterase S from Drosophila with 27.87% of identity |
Eggnog | Carboxylesterase(COG2272) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014507199.1) |
Pfam | Carboxylesterase family (PF00135.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer