| Transcript | Ll_transcript_59076 |
|---|---|
| CDS coordinates | 3-314 (+) |
| Peptide sequence | SRDMVDCLKQRPALDLLKKSIESEDDLLAMDFVPVVDGDFLPKAPLEILMEKNLPDIPWIFSNTAEDGIMPSGLFAEKFDEVNEEWSKMAPHILLFSKTQPQSD |
| ORF Type | internal |
| Blastp | Esterase S from Drosophila with 27.87% of identity |
|---|---|
| Blastx | Esterase S from Drosophila with 27.87% of identity |
| Eggnog | Carboxylesterase(COG2272) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014507199.1) |
| Pfam | Carboxylesterase family (PF00135.27) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer