Protein coding transcript 131481

• Transcript: Ll_transcript_59082
• CDS coordinates: 1-501 (+)
• Peptide sequence: EYLGHVISAGGVYADLSKTEAMRSWPQPTNLKGLRGFLGLTGYYRKFVQNYGIIARPLTELLKKDAFIWSEEATKAFNQLKHAMAELPMLALPDFSKEFVVETDASSQGLGAVLMKGGRPLAFWSKGLSVKAQLKSVYERELMALVQSVPKWRHYLMGRHFIVRTD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_59082

• Blastp: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 44.31% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 42.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442309.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;