Protein coding transcript 131482

• Transcript: Ll_transcript_59095
• CDS coordinates: 1-375 (+)
• Peptide sequence: LASTKACYEGISLVGASRVVLLDVVWNPSVERQAISRAYRLGQKKYVYTYHLITAGTREEEKICRQAEKDQLSELMFFNSDGDQQHHEKESSTEFEDQILEEMVEQEKFQRVFEKVAIKEHTLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_59095

• Blastp: SNF2 domain-containing protein CLASSY 3 from Arabidopsis with 58.82% of identity
• Blastx: SNF2 domain-containing protein CLASSY 3 from Arabidopsis with 58.82% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (AT1G05490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420610.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;