Protein coding transcript 131486

• Transcript: Ll_transcript_59037
• CDS coordinates: 2-466 (+)
• Peptide sequence: ENGITEHIKVSYKNDSKGMGYKECNDQWTEHETNFSALLESLSGQDADISKVEKPVETSLEKKSQSSKARVHYHKFTRGKDLSRYSEKDLANIFGKRTLKEKKIKKTEEPVEENNTSKIEENSSFHFNRGSMADYFKKKMPNFGKTNQLVVGNNG
• ORF Type: internal

Annotations of Ll_transcript_59037

• Blastp: PIN2/TERF1-interacting telomerase inhibitor 1 from Mus with 42.21% of identity
• Blastx: PIN2/TERF1-interacting telomerase inhibitor 1 from Mus with 41.18% of identity
• Eggnog: PIN2 TERF1 interacting, telomerase inhibitor 1(ENOG4111IXK)
• Kegg: Link to kegg annotations (72400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013447111.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;