Transcript | Ll_transcript_59037 |
---|---|
CDS coordinates | 2-466 (+) |
Peptide sequence | ENGITEHIKVSYKNDSKGMGYKECNDQWTEHETNFSALLESLSGQDADISKVEKPVETSLEKKSQSSKARVHYHKFTRGKDLSRYSEKDLANIFGKRTLKEKKIKKTEEPVEENNTSKIEENSSFHFNRGSMADYFKKKMPNFGKTNQLVVGNNG |
ORF Type | internal |
Blastp | PIN2/TERF1-interacting telomerase inhibitor 1 from Mus with 42.21% of identity |
---|---|
Blastx | PIN2/TERF1-interacting telomerase inhibitor 1 from Mus with 41.18% of identity |
Eggnog | PIN2 TERF1 interacting, telomerase inhibitor 1(ENOG4111IXK) |
Kegg | Link to kegg annotations (72400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013447111.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer