Protein coding transcript 131488

• Transcript: Ll_transcript_59043
• CDS coordinates: 3-911 (+)
• Peptide sequence: LSTTFAPVSAHLLTLPHLQNITLRSTNLSGFLPTVTNCSNSLVFVDLSHNELNGKTDFSGCINLHYLNISYNNFSSTVPSFGASTSLEYLDISGNRFSGDISGELFGCKNLIYLNASSNKLSGPVPTLPVGGVMKFLYLARNNFWGEIPVRLAQLCSSLVELDLSLNKLSGSIPGDFSSCSSLESLVLSHNGFSGELPVGVLEKMKSLRKLSLSFNGFSGPLPDSLSRMVSLEFLHLGSNKFEGSIPKGFCEDPRNSLKGLYLEDNLLTGFIPPSLGNCSHLAAMDLSLNYLKGTIPSSLGSL
• ORF Type: internal

Annotations of Ll_transcript_59043

• Blastp: Brassinosteroid LRR receptor kinase from Lycopersicon with 47.75% of identity
• Blastx: Brassinosteroid LRR receptor kinase from Lycopersicon with 47.75% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (101261320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462974.1)
• Pfam: Leucine rich repeats (6 copies) (PF13306.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;