Transcript | Ll_transcript_165549 |
---|---|
CDS coordinates | 3-401 (+) |
Peptide sequence | YHGNKEWDARLLMERFVLKPQREGGGNNIYGTEIKDALIKMKDSKERSAWILMDKINPPVTKGYIIRPGGPQVPAIVDMISELGIFGIIIGDSQKILVNRQVGHMLRTKLSTSNEGGVAAGAGALDSPYLVE* |
ORF Type | 5prime_partial |
Blastp | Glutathione synthetase from Homo with 52.99% of identity |
---|---|
Blastx | Glutathione synthetase from Homo with 52.99% of identity |
Eggnog | glutathione synthetase(ENOG410XPHH) |
Kegg | Link to kegg annotations (2937) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020211701.1) |
Pfam | Eukaryotic glutathione synthase, ATP binding domain (PF03917.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer