Protein coding transcript 131493

• Transcript: Ll_transcript_165549
• CDS coordinates: 3-401 (+)
• Peptide sequence: YHGNKEWDARLLMERFVLKPQREGGGNNIYGTEIKDALIKMKDSKERSAWILMDKINPPVTKGYIIRPGGPQVPAIVDMISELGIFGIIIGDSQKILVNRQVGHMLRTKLSTSNEGGVAAGAGALDSPYLVE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_165549

• Blastp: Glutathione synthetase from Homo with 52.99% of identity
• Blastx: Glutathione synthetase from Homo with 52.99% of identity
• Eggnog: glutathione synthetase(ENOG410XPHH)
• Kegg: Link to kegg annotations (2937)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020211701.1)
• Pfam: Eukaryotic glutathione synthase, ATP binding domain (PF03917.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;