| Transcript | Ll_transcript_165574 |
|---|---|
| CDS coordinates | 2-337 (+) |
| Peptide sequence | LCVAKWSADNTFYRAFCIARDVNDTYQVMFLEYGNTDTVPYADIRPYSEALNAFPALSSMCTLSDPPQLNELQKSKVQEMFKENWTVKATVVKIDDGACVLDIPEIRSALP* |
| ORF Type | 5prime_partial |
| Blastp | Ribonuclease TUDOR 1 from Arabidopsis with 31.43% of identity |
|---|---|
| Blastx | Ribonuclease TUDOR 1 from Arabidopsis with 31.43% of identity |
| Eggnog | nuclease(COG1525) |
| Kegg | Link to kegg annotations (AT5G07350) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014509090.1) |
| Pfam | Tudor domain (PF00567.23) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer