Protein coding transcript 1315

• Transcript: Ll_transcript_301274
• CDS coordinates: 69-458 (+)
• Peptide sequence: MQVMNSTMQMEASAPLPIKLEKSPYEVVHLLSSSNAVVVFSTTDCCMSTVAKRLLFSLGVGPTVVELDEHVAGHDIKAFLYQLAGTTLQPPIPAVFIGGKFLGGVEALMANHINGTLIPLLKEAGALWL*
• ORF Type: complete

Annotations of Ll_transcript_301274

• Blastp: Monothiol glutaredoxin-S10 from Arabidopsis with 50% of identity
• Blastx: Monothiol glutaredoxin-S10 from Arabidopsis with 50% of identity
• Eggnog: Glutaredoxin(COG0695)
• Kegg: Link to kegg annotations (AT3G21460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463207.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;