Protein coding transcript 131504

• Transcript: Ll_transcript_165524
• CDS coordinates: 78-812 (+)
• Peptide sequence: MAASGNSSGGGLLPELTQRTPILGLKLYLIILFFIVILVSTLLIFFICIMKRRMRMRVKHSSGTIPLVSKEESEMKSGEKERRRRRKSEEEKEKIGWGRRYSLKEVEEATRGFEEGNVIGKGGYGIVYRGILHDASVVAVKNLLNNNKGQAEKEFKGEVEAIGKVRHKHLVGLVGYCAEGAQRMLVYEYIDNGTLEQWLHGDVGPVSPLTWDIRMKVAVGIAKGLAYLHEGLEPKVVHRDVKSSN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_165524

• Blastp: Probable receptor-like serine/threonine-protein kinase At4g34500 from Arabidopsis with 57.91% of identity
• Blastx: Probable receptor-like serine/threonine-protein kinase At4g34500 from Arabidopsis with 60% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G34500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416485.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;