Protein coding transcript 131506

• Transcript: Ll_transcript_165489
• CDS coordinates: 2-346 (+)
• Peptide sequence: LDYGKWELILPPKPDGSCMVPHLSEVKVVIENHHGHKLDKLSPYATYVVEPPKDQGTIYKQKMWNPPQSERYLFKHPKTPRPKSLRIYECHVGIATSELKVGDYDNFTDNILPRI
• ORF Type: internal

Annotations of Ll_transcript_165489

• Blastp: 1,4-alpha-glucan-branching enzyme from Equus with 50% of identity
• Blastx: 1,4-alpha-glucan-branching enzyme from Equus with 50% of identity
• Eggnog: Catalyzes the formation of the alpha-1,6-glucosidic linkages in glycogen by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the subsequent attachment of the oligosaccharide to the alpha-1,6 position (By similarity)(COG0296)
• Kegg: Link to kegg annotations (100034152)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014495800.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;