Protein coding transcript 131509

• Transcript: Ll_transcript_165569
• CDS coordinates: 1-468 (-)
• Peptide sequence: MPLQPFNPLFKPYLRKFVLVFFDDILVYSKGWQEHVEHLTTVMEVLQNQQFVANRKKCVFGNREVEYLGHLIFYQGAAVDPEKIRSVIEWPIPRNVRGVRAFLGLTGYYRKFIAGYGKIVKPLTELTKEGFNWNPTALEAFEELKMMTQAPVLTLP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_165569

• Blastp: Uncharacterized mitochondrial protein AtMg00860 from Arabidopsis with 48% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 38.31% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp075)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017417578.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;