Protein coding transcript 131515

• Transcript: Ll_transcript_198585
• CDS coordinates: 46-360 (+)
• Peptide sequence: MDSGQKLHSKSGTLYSNPTAYRRLIGRLIYLTHTRPDISFSVSHLSQFLSTTTTDHFNAGLKILRYLNHAPGKGLYFPSNTKISLKGFSDSDWGSCLDTRRSVT*
• ORF Type: complete

Annotations of Ll_transcript_198585

• Blastp: Uncharacterized mitochondrial protein AtMg00240 from Arabidopsis with 50% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 45.86% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp021)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447235.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;