Protein coding transcript 131516

• Transcript: Ll_transcript_198543
• CDS coordinates: 39-371 (+)
• Peptide sequence: MSQIRSKATLPCLKFEYKDLEPIISRDIMEIHHQKHHNTYVVNYNNTLDKLQTAVAKDDTAAIISLSPALKFNGGGHINHSIFWDTLTPHSTKPSDDLNKALIQNFGSCDE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_198543

• Blastp: Superoxide dismutase [Mn], mitochondrial from Sophophora with 56.48% of identity
• Blastx: Superoxide dismutase [Mn], mitochondrial from Sophophora with 56.48% of identity
• Eggnog: Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity)(COG0605)
• Kegg: Link to kegg annotations (Dmel_CG8905)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003526813.1)
• Pfam: Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;