Protein coding transcript 131518

• Transcript: Ll_transcript_198520
• CDS coordinates: 2-370 (+)
• Peptide sequence: NRRRGKNENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINQADIVLIGLREYQDTKADVILKYTPDEARNLKTYGEFPETVRINDTVTFVDDGLDEDIEFG
• ORF Type: internal

Annotations of Ll_transcript_198520

• Blastp: Eukaryotic translation initiation factor 1A, X-chromosomal from Pongo with 79.51% of identity
• Blastx: Eukaryotic translation initiation factor 1A, X-chromosomal from Pongo with 79.51% of identity
• Eggnog: however, it seems to stimulate more or less all the activities of the other two initiation factors, IF-2 and IF-3 (By similarity)(COG0361)
• Kegg: Link to kegg annotations (100172735)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003548603.1)
• Pfam: Translation initiation factor 1A / IF-1 (PF01176.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;