Protein coding transcript 131519

• Transcript: Ll_transcript_198527
• CDS coordinates: 3-311 (+)
• Peptide sequence: EILGDASLKSIWLKDVKGMADRIISMRTQLQDNLKKEGSSLNWAHITDQIGMFCFTGMKPDQVERLTKDFSVYLTKDGRISMAGVTSKNVGYLAKAMHEATK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_198527

• Blastp: Aspartate aminotransferase, mitochondrial from Mus with 77.23% of identity
• Blastx: Aspartate aminotransferase, mitochondrial from Mus with 77.23% of identity
• Eggnog: aminotransferase(COG1448)
• Kegg: Link to kegg annotations (14719)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414111.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;