Protein coding transcript 131522

• Transcript: Ll_transcript_198551
• CDS coordinates: 3-356 (+)
• Peptide sequence: LAKSCQFVSKYYIAAKKNLEKSKSVIDEGVKWSKHALEMYPGNCNAHKWFAICSGARGQLGSTKEKIEGGYIFQNHINEAIKINSRDPTLYYLKGKLEYEVAVLSSFDRRIASWLYGE
• ORF Type: internal

Annotations of Ll_transcript_198551

• Blastp: Regulator of microtubule dynamics protein 1 from Bos with 38.78% of identity
• Blastx: Regulator of microtubule dynamics protein 1 from Bos with 38.78% of identity
• Eggnog: Family with sequence similarity 82, member B(ENOG410ZMYH)
• Kegg: Link to kegg annotations (513788)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003613573.2)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;