Protein coding transcript 131524

• Transcript: Ll_transcript_198517
• CDS coordinates: 1-585 (+)
• Peptide sequence: QNGRYHHAIVHDHGEVILSAGAIGSPQLLLLSGIGPRPYLSSWGIPVAYHLPYVGHFLYDNPRNGITLVPSVPLEHSLIQVVGITDSGAYIEAASNVIPFVSPSQSVFIRNPSSPLYLTVATLIAKISGPLSSGFLRLASTDVKLNPIVRFNYFNNPVDLERCVNGTRKIGDVLRSRALNDFKFRNWLGDQDFRF
• ORF Type: internal

Annotations of Ll_transcript_198517

• Blastp: (R)-mandelonitrile lyase-like from Arabidopsis with 70.26% of identity
• Blastx: (R)-mandelonitrile lyase-like from Arabidopsis with 70.26% of identity
• Eggnog: oxidoreductase(COG2303)
• Kegg: Link to kegg annotations (AT1G73050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455535.1)
• Pfam: GMC oxidoreductase (PF00732.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;