Protein coding transcript 131526

• Transcript: Ll_transcript_198552
• CDS coordinates: 95-547 (+)
• Peptide sequence: MERNHSHKQVAAMKQSLFDQGHLDEQFIQLEELQDDANPNFVEEIVTLYYHDSSRLISNMDQALERNPLDFNKLDNIMHQFKGSSSSIGAKKVKAECTLFREYCRTANAEGCRKSFQQLKKEYLALRKKFEAYFQLARQVGPLESACCPR*
• ORF Type: complete

Annotations of Ll_transcript_198552

• Blastp: Histidine-containing phosphotransfer protein 4 from Arabidopsis with 72.27% of identity
• Blastx: Histidine-containing phosphotransfer protein 4 from Arabidopsis with 72.27% of identity
• Eggnog: Histidine kinase(COG2198)
• Kegg: Link to kegg annotations (AT3G16360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448189.1)
• Pfam: Hpt domain (PF01627.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;