| Transcript | Ll_transcript_198595 |
|---|---|
| CDS coordinates | 3-350 (+) |
| Peptide sequence | DIHRRPSTSHAAFSTQPHTTSKNRVKRPKSLEMAPKQAQKTPTTAGKAPAGKAPAEKKEAGKKTAAVSGDKKKRTKTRKETYSSYIYKVLKQVHPDTVISNRAMSILNSFVNDIFE |
| ORF Type | internal |
| Blastp | Histone H2B from Aspergillus with 88.24% of identity |
|---|---|
| Blastx | Histone H2B from Neurospora with 94% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003606631.1) |
| Pfam | Core histone H2A/H2B/H3/H4 (PF00125.23) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer