Protein coding transcript 131529

• Transcript: Ll_transcript_198560
• CDS coordinates: 1-309 (+)
• Peptide sequence: GQLKKILEAIKELLKEATFDCSDSGIQLQAMDDAHVSLVSMCLKSTGFDKFRCDRNLSMGINLEIMVKIMKCCSNDDIMTIKAQDNADTLTIMFETSNQEKMS
• ORF Type: internal

Annotations of Ll_transcript_198560

• Blastp: Proliferating cell nuclear antigen from Sophophora with 76.24% of identity
• Blastx: Proliferating cell nuclear antigen from Sophophora with 75.58% of identity
• Eggnog: DNA polymerase processivity factor activity(COG0592)
• Kegg: Link to kegg annotations (Dmel_CG9193)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013460113.1)
• Pfam: Proliferating cell nuclear antigen, N-terminal domain (PF00705.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;