Protein coding transcript 131531

• Transcript: Ll_transcript_198530
• CDS coordinates: 121-426 (+)
• Peptide sequence: MARSFSNVKLFSVPLFDGFSHFLARHGYSATTTQSARMGGATYVSGKITPKSVDEKIKNGVVSENVSWVPDPITGYYQPENIKETDVAELRASHVNKKFNH*
• ORF Type: complete

Annotations of Ll_transcript_198530

• Blastp: Indole-3-acetic acid-induced protein ARG2 from Vigna with 54.37% of identity
• Blastx: Indole-3-acetic acid-induced protein ARG2 from Vigna with 54.37% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428794.1)
• Pfam: Late embryogenesis abundant protein (PF03242.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;