| Transcript | Ll_transcript_198566 |
|---|---|
| CDS coordinates | 2-385 (+) |
| Peptide sequence | FGLVVFSWEKKRAWRVTDHLFFPDPLAARYTLHDLEFDWTDGIFGLALSPYDTNKDDRLLYFHPMSSFREFYVKTSVICNETGWMDVKNAFKVMGQSRGPSGHVSTSAVDRNGIMFFNMVTRDTVGYW |
| ORF Type | internal |
| Blastp | Protein yellow from Sophophora with 36.92% of identity |
|---|---|
| Blastx | Protein yellow from Sophophora with 36.92% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_016166831.1) |
| Pfam | Major royal jelly protein (PF03022.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer