Transcript | Ll_transcript_198578 |
---|---|
CDS coordinates | 954-1454 (+) |
Peptide sequence | MAGIATAEICDTNVTHITNGDLRVLHPDFNIYGQSRAFSGPIVTLKVFEDNVLVREVLETEGEGRVLVIDGGGSKRCALLGGNLGQLAHSKGWCGIVVNGCIRDVDEINECGIGVRALASHPLKSNKKGNGEKHVPVYVGGTLIRDGEWLYADNDGILVSKFELSI* |
ORF Type | complete |
Blastp | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3 from Arabidopsis with 77.11% of identity |
---|---|
Blastx | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3 from Arabidopsis with 77.11% of identity |
Eggnog | Globally modulates RNA abundance by binding to RNase E (Rne) and regulating its endonucleolytic activity. Can modulate Rne action in a substrate-dependent manner by altering the composition of the degradosome. Modulates RNA-binding and helicase activities of the degradosome (By similarity)(COG0684) |
Kegg | Link to kegg annotations (AT5G56260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423183.1) |
Pfam | Aldolase/RraA (PF03737.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer