Protein coding transcript 131535

• Transcript: Ll_transcript_198579
• CDS coordinates: 189-689 (+)
• Peptide sequence: MAGIATAEICDTNVTHITNGDLRVLHPDFNIYGQSRAFSGPIVTLKVFEDNVLVREVLETEGEGRVLVIDGGGSKRCALLGGNLGQLAHSKGWCGIVVNGCIRDVDEINECGIGVRALASHPLKSNKKGNGEKHVPVYVGGTLIRDGEWLYADNDGILVSKFELSI*
• ORF Type: complete

Annotations of Ll_transcript_198579

• Blastp: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3 from Arabidopsis with 77.11% of identity
• Blastx: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3 from Arabidopsis with 77.11% of identity
• Eggnog: Globally modulates RNA abundance by binding to RNase E (Rne) and regulating its endonucleolytic activity. Can modulate Rne action in a substrate-dependent manner by altering the composition of the degradosome. Modulates RNA-binding and helicase activities of the degradosome (By similarity)(COG0684)
• Kegg: Link to kegg annotations (AT5G56260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423183.1)
• Pfam: Aldolase/RraA (PF03737.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;