Protein coding transcript 131540

• Transcript: Ll_transcript_170220
• CDS coordinates: 2-430 (+)
• Peptide sequence: MAFDGINFKGQSLKIRRPHDYQPTPGMTESNPVTNYNSGMTLDMMKYDSSSFGLGTVPDSPHKIFIGGLPAYLNDEQVKELLTSFGQLKAFNLVKDAATGLSKGYAFCEYADVVMTDQAIAGLNGMQLGEKKLIVQRASIGAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_170220

• Blastp: Splicing factor U2AF 50 kDa subunit from Sophophora with 71.33% of identity
• Blastx: Splicing factor U2AF 50 kDa subunit from Sophophora with 71.33% of identity
• Eggnog: splicing factor (U2AF)(ENOG410XP92)
• Kegg: Link to kegg annotations (Dmel_CG9998)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016204586.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;