Protein coding transcript 131542

• Transcript: Ll_transcript_170198
• CDS coordinates: 115-693 (+)
• Peptide sequence: MSPSPIQPKIEVTNNLNKDLKTNRVSHSIKKASCSSMLVPSNKPQQQRQPVIIYTHSPKIIETHPKDFKALVQKLTGLSQDHSGEKDEETNPISNCIPPPQLPRPEVAVEEAIMEVKYPKKENETSSVITEENNCGYSCMGEVKSCFMDVPSMMMEPPMMPYMRNLPAYEPNSMEFMNPNMSFLNYPESFFF*
• ORF Type: complete

Annotations of Ll_transcript_170198

• Blastp: VQ motif-containing protein 20 from Arabidopsis with 37.68% of identity
• Blastx: VQ motif-containing protein 20 from Arabidopsis with 37.5% of identity
• Eggnog: VQ motif(ENOG410Z9YD)
• Kegg: Link to kegg annotations (AT3G18360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435176.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;