Protein coding transcript 131543

• Transcript: Ll_transcript_170163
• CDS coordinates: 39-440 (+)
• Peptide sequence: MGVHKRVPGIISLLFLISVLLEFNVVYSYTRPPPRNNILSDIDPSDPQQVRIAKVGKDRMRISWFTIYPTPATVQYGLTRSADTFNATGVIDSYHYILYYSGPVHNVVIGPLKPNRVYYYRMGESTKVYNFKTA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_170163

• Blastp: Probable purple acid phosphatase 20 from Arabidopsis with 42.22% of identity
• Blastx: Probable purple acid phosphatase 20 from Arabidopsis with 45.22% of identity
• Eggnog: Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409)
• Kegg: Link to kegg annotations (AT3G52780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442476.1)
• Pfam: Purple acid Phosphatase, N-terminal domain (PF16656.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;