Protein coding transcript 131544

• Transcript: Ll_transcript_170206
• CDS coordinates: 2-331 (+)
• Peptide sequence: FFEYIKVFGIEDLVSFDLSLARGLDYYTGIIYEVVLLDKGQSVGSVAGGGRYDNLVGMFHPKNKTIPCVGISLGVERLFTVIEAKLAKEKQKMRTTEVQVFVAAAQKNLV
• ORF Type: internal

Annotations of Ll_transcript_170206

• Blastp: Histidine--tRNA ligase, cytoplasmic from Homo with 59.83% of identity
• Blastx: Histidine--tRNA ligase, cytoplasmic from Homo with 59.83% of identity
• Eggnog: Histidyl-trna synthetase(COG0124)
• Kegg: Link to kegg annotations (3035)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004497677.1)
• Pfam: Histidyl-tRNA synthetase (PF13393.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;