Protein coding transcript 131548

• Transcript: Ll_transcript_170190
• CDS coordinates: 90-419 (+)
• Peptide sequence: MSAAAQTVLASAKRLVPLFDRVLIQRAEAVTKTKGGIVIPEKAQGKVLTGKVIAVGPGSRNSEGQHVPVSVKVGDQVLLPEYGGTKVELEENKEFHLFRESDILAKIES*
• ORF Type: complete

Annotations of Ll_transcript_170190

• Blastp: 10 kDa heat shock protein, mitochondrial from Schistosoma with 65.62% of identity
• Blastx: 10 kDa heat shock protein, mitochondrial from Schistosoma with 65.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020213098.1)
• Pfam: Chaperonin 10 Kd subunit (PF00166.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;