Transcript | Ll_transcript_170190 |
---|---|
CDS coordinates | 90-419 (+) |
Peptide sequence | MSAAAQTVLASAKRLVPLFDRVLIQRAEAVTKTKGGIVIPEKAQGKVLTGKVIAVGPGSRNSEGQHVPVSVKVGDQVLLPEYGGTKVELEENKEFHLFRESDILAKIES* |
ORF Type | complete |
Blastp | 10 kDa heat shock protein, mitochondrial from Schistosoma with 65.62% of identity |
---|---|
Blastx | 10 kDa heat shock protein, mitochondrial from Schistosoma with 65.62% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020213098.1) |
Pfam | Chaperonin 10 Kd subunit (PF00166.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer