Protein coding transcript 131553

• Transcript: Ll_transcript_239417
• CDS coordinates: 3-311 (+)
• Peptide sequence: QVTASSNDDAIEHPNSKPGRPSGNREAVRKYREKKKERIAFLEEEVEKLRLSNRKLVRKLQGKAALEAELSRLRSILSCLKGKIDNELGVLAFPKERTSSLH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_239417

• Blastp: Basic leucine zipper 23 from Arabidopsis with 53.26% of identity
• Blastx: Basic leucine zipper 23 from Arabidopsis with 53.26% of identity
• Eggnog: Transcription factor(ENOG4111N0E)
• Kegg: Link to kegg annotations (AT2G16770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443567.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;