Protein coding transcript 131557

• Transcript: Ll_transcript_239414
• CDS coordinates: 2-364 (+)
• Peptide sequence: FDRLNTSILNQHLHELMDGLTAKVFRTFNASWTLQQQLEKLTDPDVSVAEKILQYNRANRAVAILCNHQRAIPKTHEKSMGNLKEKIQTKRAAVKEAKEQYKQAKRDVKDGSVHSKTQLEK
• ORF Type: internal

Annotations of Ll_transcript_239414

• Blastp: DNA topoisomerase 1 from Sophophora with 67.57% of identity
• Blastx: DNA topoisomerase 1 from Sophophora with 67.57% of identity
• Eggnog: Dna topoisomerase(COG3569)
• Kegg: Link to kegg annotations (Dmel_CG6146)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013466945.1)
• Pfam: Eukaryotic DNA topoisomerase I, catalytic core (PF01028.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;