Protein coding transcript 131558

• Transcript: Ll_transcript_239498
• CDS coordinates: 3-320 (+)
• Peptide sequence: TVNFEQSDAGSPVQVTGQLAGLTKGLHGFHVHEFGDNTNGCTSAGPHFNPQGKDHGAPTDADRHVGDLGNVEAGADGVAKIQISDKLISLTGPNSIIGRTVVVHAD
• ORF Type: internal

Annotations of Ll_transcript_239498

• Blastp: Superoxide dismutase [Cu-Zn] from Ceratitis with 74.53% of identity
• Blastx: Superoxide dismutase [Cu-Zn] from Ceratitis with 74.53% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003626362.1)
• Pfam: Copper/zinc superoxide dismutase (SODC) (PF00080.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;