Transcript | Ll_transcript_239412 |
---|---|
CDS coordinates | 1-423 (+) |
Peptide sequence | LRHSESDHEQTKKIAVSQSQLEEGQGAMKKNLEDGMAMIKDSYNYLGQEIEKLKDEAIEIEKEVTKVGDAMSIKMTSLHDKAEDIGNMAGISLDKQQQVLDGQYMALKGLNSLSEIQSKAIEESRKTLQNFAEYGHRQHEE |
ORF Type | internal |
Blastp | Protein GAMETE EXPRESSED 1 from Arabidopsis with 43.85% of identity |
---|---|
Blastx | Protein GAMETE EXPRESSED 1 from Arabidopsis with 43.85% of identity |
Eggnog | NA(ENOG41121QC) |
Kegg | Link to kegg annotations (AT5G55490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444829.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer