Protein coding transcript 131563

• Transcript: Ll_transcript_239443
• CDS coordinates: 22-312 (+)
• Peptide sequence: MNPFFTIPLFFFIILSLTPSYGYDSLDPYGNITVTWDFLADNGDTVDVKVSIYNFQLFRHVEQPGWRLGWAWTGDEVIWAMLGAEATEQGNCTRFRG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_239443

• Blastp: COBRA-like protein 1 from Arabidopsis with 52.13% of identity
• Blastx: COBRA-like protein 2 from Arabidopsis with 56.58% of identity
• Eggnog: cobra-like protein(ENOG410YAAC)
• Kegg: Link to kegg annotations (AT3G02210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418461.1)
• Pfam: COBRA-like protein (PF04833.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;