Protein coding transcript 131565

• Transcript: Ll_transcript_239490
• CDS coordinates: 2-487 (+)
• Peptide sequence: FSQLGLNAPSGVLLCGPPGCGKTLLAKAVANEAGINFISVKGPELLNMYVGESERAVRQVCQRARNSAPCVIFFDELDALCPKRSDSGDNGVSSRVVNQLLTEMDGVEGRSAVYLMAASNRPDIIDPAVLRPGRLDKIIYVGLPNAEDRTDILRALTKNGTK
• ORF Type: internal

Annotations of Ll_transcript_239490

• Blastp: Nuclear valosin-containing protein-like from Homo with 77.16% of identity
• Blastx: Nuclear valosin-containing protein-like from Homo with 77.16% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (4931)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003593030.1)
• Pfam: Holliday junction DNA helicase ruvB N-terminus (PF05496.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;