Protein coding transcript 131570

• Transcript: Ll_transcript_140031
• CDS coordinates: 1-318 (+)
• Peptide sequence: EAFKIITSDPKVCAIMVNIFGGIMRCDIIADGIIAAAQELNLNVPIICRLQGTNVDEAKLRIANSGMKILPVDNLDEAARLAVKLSEIVNLAREQHLGVNFEMPI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_140031

• Blastp: Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial from Homo with 63.81% of identity
• Blastx: Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial from Homo with 63.81% of identity
• Eggnog: Succinyl-CoA synthetase subunit beta(COG0045)
• Kegg: Link to kegg annotations (8803)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016182998.1)
• Pfam: CoA-ligase (PF00549.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;