Protein coding transcript 131571

• Transcript: Ll_transcript_140032
• CDS coordinates: 1-372 (+)
• Peptide sequence: RVYARKEFYFAVMMERAFGGPVLIASSQGGVNIEKVAEDNPEAILYMPIDITKGISRELALDVITKVGLTKKKDETADVILKLYDLFLTKDALLIEVNPYAESISTGGYYCLDAKFRFDDNAEY
• ORF Type: internal

Annotations of Ll_transcript_140032

• Blastp: Succinate--CoA ligase [ADP-forming] subunit beta, hydrogenosomal from Neocallimastix with 52.8% of identity
• Blastx: Succinate--CoA ligase [ADP-forming] subunit beta, hydrogenosomal from Neocallimastix with 52.8% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015948865.1)
• Pfam: ATP-grasp domain (PF08442.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;