Protein coding transcript 131573

• Transcript: Ll_transcript_140014
• CDS coordinates: 2-298 (+)
• Peptide sequence: GSTVSAYLPQNFTGPRWINVLINAIVFLQSITSQHVFVAPIHEALDTRFLDINKGMHKGKNLKRLFLLRAIFFSGNTLVAAAFPFMSDFVNLLGSFSLV
• ORF Type: internal

Annotations of Ll_transcript_140014

• Blastp: Proline transporter 1 from Oryza sativa with 39.18% of identity
• Blastx: Proline transporter 1 from Oryza sativa with 39.18% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (4333560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457355.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;