Protein coding transcript 131574

• Transcript: Ll_transcript_140071
• CDS coordinates: 3-401 (+)
• Peptide sequence: FSDFGKLPLSYGVGILGMPGNTAYFGFLELCQPKAGETVVVSGAAGAVGSIVGQIAKIKGCKVIGIAGSDEKGKWLTEELNFDHFINYKTQNVFKTLKQVAPKGVDCYFDNVGGEISSMVLNNMNLYGRISVC
• ORF Type: internal

Annotations of Ll_transcript_140071

• Blastp: Putative NADP-dependent oxidoreductase YfmJ from Bacillus with 62.12% of identity
• Blastx: Prostaglandin reductase 1 from Bos with 60.94% of identity
• Eggnog: alcohol dehydrogenase(COG2130)
• Kegg: Link to kegg annotations (BSU07450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020990340.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;